PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00037.1.g03450.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 210aa    MW: 22836.4 Da    PI: 8.7806
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00037.1.g03450.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.62.3e-4061138178
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     +CqvegC  dl  akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Zjn_sc00037.1.g03450.1.sm.mkhc  61 RCQVEGCGLDLGGAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKQQP 138
                                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-3355123IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.87259136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.08E-3860141IPR004333Transcription factor, SBP-box
PfamPF031109.4E-3162136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEWTVPKPAA SPSSPPLLWD WGDSAAPASG SSGEAPARRG GKEREGKRAK GGEDGGGGEV  60
RCQVEGCGLD LGGAKEYHRK HRVCEAHTKC PRVVVAGQER RFCQQCSRFH ALSEFDQKKR  120
SCRRRLSDHN ARRRKQQPDA FAFASARLPT SLFGTSENSG DLHLSHGGSA ALVSCADEQH  180
IVPQPQLVRF TMDASSNGYD STFFGLNQIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2752135184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117134KKRSCRRRLSDHNARRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.14e-93PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ6H5098e-63SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLK3YU035e-93K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m1e-92(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-40squamosa promoter binding protein-like 2